PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.H02314.1.p
Common NameLOC105965012, MIMGU_mgv1a026983mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family ZF-HD
Protein Properties Length: 262aa    MW: 27954.2 Da    PI: 7.9345
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.H02314.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.64.5e-3150105359
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                       + rYkeClkNhA+ +GghavDGCgEf+p+ ge+gt ++l+CaAC+CHRnFHR+e+e 
  Migut.H02314.1.p  50 RHRYKECLKNHAVGMGGHAVDGCGEFLPA-GEDGTLESLRCAACNCHRNFHRKENEG 105
                       679*************************9.999********************9875 PP

2Homeobox14.27.4e-05199254152
                       TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrR 52 
                       +r Rt+ft+eq e + +l e    + ++ ++e+ ++L  ++g++  + kvW +N +
  Migut.H02314.1.p 199 KRARTKFTAEQKEKMLNLAErlewRIQKQDEEMVQQLCGEMGIKRHVLKVWMHNNK 254
                       799**********99888886655689999************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-2230104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.8E-2851103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.6E-3052102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.82253102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.41E-18184259IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-29187260IPR009057Homeodomain-like
PROSITE profilePS500718.762196260IPR001356Homeobox domain
TIGRFAMsTIGR015651.3E-24198254IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MEYEDQDDPG ESGSGPGYND SLGNSNSTHP PTKLPSPVGE AAGTPPPLRR HRYKECLKNH  60
AVGMGGHAVD GCGEFLPAGE DGTLESLRCA ACNCHRNFHR KENEGAAAAA AVGGGGAFPL  120
HQYPHHQQMF LTHHPHGHFG YRGPTGYLQV APPRAAAPPP LALPSSSGGG AGSGSRDEME  180
EYYSNPSSSG GGGGAAAKKR ARTKFTAEQK EKMLNLAERL EWRIQKQDEE MVQQLCGEMG  240
IKRHVLKVWM HNNKVTLGKK T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A7e-231992541873ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012844976.10.0PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ6YXH54e-65ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLA0A022QWS40.0A0A022QWS4_ERYGU; Uncharacterized protein
STRINGGLYMA02G04550.28e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.16e-55homeobox protein 22